PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G080200.1
Common NameB456_013G080200, LOC105784055
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 443aa    MW: 48939.8 Da    PI: 7.7613
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G080200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.7e-32275330156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W++eLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Gorai.013G080200.1 275 KQRRCWSSELHKRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 330
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.248272332IPR017930Myb domain
SuperFamilySSF466896.05E-18273333IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-28273333IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-27275330IPR006447Myb domain, plants
PfamPF002494.3E-7277328IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MILFILYILL KKNITTNSLD LASLILFGSL YALWSETNPF PSHIFISSTV SENPRCGRNK  60
ITFLSKENFL AMIDMDYAQK MRKCHEYVEA LEEERRKIQV FQRELPLCFE LVTQAIESCK  120
KEMYMQGQSE CSEQTSSDSP VLEEFIPIKR SCNCSEEDDD DDDENVAAAD KKKSDWLRSV  180
QLWNPPSKED VGKTGSGVQM KGNGGAFQPF HKEKGNVEKK SVEAVGKGNA SATATTTTTS  240
ASTTESGSRG IAADDGNTDK KVEKGQQQQQ PPQRKQRRCW SSELHKRFLH ALQQLGGSHV  300
ATPKQIRELM KVDGLTNDEV KSHLQKYRLH TRRPCPSINS NGNNPQTPQF VVVGGIWVPP  360
QEYASVATTA AVSGETSVTP SPNSGVYAPV AVPLPTLAKP SVQRPQRSQS EDRGSHSEGR  420
VHSNSPSTSS STHTTTDRFP AF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465287.10.0PREDICTED: uncharacterized protein LOC105784055
TrEMBLA0A0D2SAH50.0A0A0D2SAH5_G
STRINGVIT_01s0011g03110.t011e-132(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.14e-90G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]